Brand: | Abnova |
Reference: | H00026258-M10 |
Product name: | PLDN monoclonal antibody (M10), clone 3D2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PLDN. |
Clone: | 3D2 |
Isotype: | IgG1 Kappa |
Gene id: | 26258 |
Gene name: | PLDN |
Gene alias: | PA|PALLID |
Gene description: | pallidin homolog (mouse) |
Genbank accession: | BC004819 |
Immunogen: | PLDN (AAH04819, 1 a.a. ~ 172 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM |
Protein accession: | AAH04819 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (44.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PLDN is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |