PLDN monoclonal antibody (M01), clone 2H8 View larger

PLDN monoclonal antibody (M01), clone 2H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLDN monoclonal antibody (M01), clone 2H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PLDN monoclonal antibody (M01), clone 2H8

Brand: Abnova
Reference: H00026258-M01
Product name: PLDN monoclonal antibody (M01), clone 2H8
Product description: Mouse monoclonal antibody raised against a partial recombinant PLDN.
Clone: 2H8
Isotype: IgG2a Kappa
Gene id: 26258
Gene name: PLDN
Gene alias: PA|PALLID
Gene description: pallidin homolog (mouse)
Genbank accession: NM_012388
Immunogen: PLDN (NP_036520.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSML
Protein accession: NP_036520.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026258-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026258-M01-13-15-1.jpg
Application image note: Western Blot analysis of PLDN expression in transfected 293T cell line by PLDN monoclonal antibody (M01), clone 2H8.

Lane 1: PLDN transfected lysate(19.7 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PLDN monoclonal antibody (M01), clone 2H8 now

Add to cart