CLEC4E monoclonal antibody (M08), clone 2D12 View larger

CLEC4E monoclonal antibody (M08), clone 2D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLEC4E monoclonal antibody (M08), clone 2D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about CLEC4E monoclonal antibody (M08), clone 2D12

Brand: Abnova
Reference: H00026253-M08
Product name: CLEC4E monoclonal antibody (M08), clone 2D12
Product description: Mouse monoclonal antibody raised against a full length recombinant CLEC4E.
Clone: 2D12
Isotype: IgG2a Kappa
Gene id: 26253
Gene name: CLEC4E
Gene alias: CLECSF9|MINCLE
Gene description: C-type lectin domain family 4, member E
Genbank accession: BC000715
Immunogen: CLEC4E (AAH00715, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL
Protein accession: AAH00715
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026253-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.83 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged CLEC4E is approximately 3ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Mincle and human B cell function.Kawata K, Illarionov P, Kenny TP, Zhang W, Tsuda M, Ando Y, Leung PS, Ansari AA, Eric Gershwin M.
J Autoimmun. 2012 Jun 12.

Reviews

Buy CLEC4E monoclonal antibody (M08), clone 2D12 now

Add to cart