CLEC4E monoclonal antibody (M01A), clone 2F2 View larger

CLEC4E monoclonal antibody (M01A), clone 2F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLEC4E monoclonal antibody (M01A), clone 2F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CLEC4E monoclonal antibody (M01A), clone 2F2

Brand: Abnova
Reference: H00026253-M01A
Product name: CLEC4E monoclonal antibody (M01A), clone 2F2
Product description: Mouse monoclonal antibody raised against a full length recombinant CLEC4E.
Clone: 2F2
Isotype: IgM Kappa
Gene id: 26253
Gene name: CLEC4E
Gene alias: CLECSF9|MINCLE
Gene description: C-type lectin domain family 4, member E
Genbank accession: BC000715
Immunogen: CLEC4E (AAH00715, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL
Protein accession: AAH00715
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026253-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.83 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CLEC4E monoclonal antibody (M01A), clone 2F2 now

Add to cart