Brand: | Abnova |
Reference: | H00026253-M01A |
Product name: | CLEC4E monoclonal antibody (M01A), clone 2F2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CLEC4E. |
Clone: | 2F2 |
Isotype: | IgM Kappa |
Gene id: | 26253 |
Gene name: | CLEC4E |
Gene alias: | CLECSF9|MINCLE |
Gene description: | C-type lectin domain family 4, member E |
Genbank accession: | BC000715 |
Immunogen: | CLEC4E (AAH00715, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL |
Protein accession: | AAH00715 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (49.83 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |