Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00026232-M01 |
Product name: | FBXO2 monoclonal antibody (M01), clone 1G4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FBXO2. |
Clone: | 1G4 |
Isotype: | IgG1 Kappa |
Gene id: | 26232 |
Gene name: | FBXO2 |
Gene alias: | FBG1|FBX2|Fbs1|NFB42 |
Gene description: | F-box protein 2 |
Genbank accession: | BC025233 |
Immunogen: | FBXO2 (AAH25233, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP |
Protein accession: | AAH25233 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FBXO2 expression in transfected 293T cell line by FBXO2 monoclonal antibody (M01), clone 1G4. Lane 1: FBXO2 transfected lysate(33.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |