FBXO2 monoclonal antibody (M01), clone 1G4 View larger

FBXO2 monoclonal antibody (M01), clone 1G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXO2 monoclonal antibody (M01), clone 1G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Tr

More info about FBXO2 monoclonal antibody (M01), clone 1G4

Brand: Abnova
Reference: H00026232-M01
Product name: FBXO2 monoclonal antibody (M01), clone 1G4
Product description: Mouse monoclonal antibody raised against a full length recombinant FBXO2.
Clone: 1G4
Isotype: IgG1 Kappa
Gene id: 26232
Gene name: FBXO2
Gene alias: FBG1|FBX2|Fbs1|NFB42
Gene description: F-box protein 2
Genbank accession: BC025233
Immunogen: FBXO2 (AAH25233, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Protein accession: AAH25233
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026232-M01-13-15-1.jpg
Application image note: Western Blot analysis of FBXO2 expression in transfected 293T cell line by FBXO2 monoclonal antibody (M01), clone 1G4.

Lane 1: FBXO2 transfected lysate(33.3 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FBXO2 monoclonal antibody (M01), clone 1G4 now

Add to cart