Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00026228-M01 |
Product name: | BRDG1 monoclonal antibody (M01), clone 5A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BRDG1. |
Clone: | 5A10 |
Isotype: | IgG1 Kappa |
Gene id: | 26228 |
Gene name: | STAP1 |
Gene alias: | BRDG1|STAP-1 |
Gene description: | signal transducing adaptor family member 1 |
Genbank accession: | NM_012108 |
Immunogen: | BRDG1 (NP_036240, 186 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPH |
Protein accession: | NP_036240 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of BRDG1 expression in transfected 293T cell line by BRDG1 monoclonal antibody (M01), clone 5A10. Lane 1: BRDG1 transfected lysate(34.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |