PHGDH monoclonal antibody (M01), clone 4A3-1D6 View larger

PHGDH monoclonal antibody (M01), clone 4A3-1D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHGDH monoclonal antibody (M01), clone 4A3-1D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about PHGDH monoclonal antibody (M01), clone 4A3-1D6

Brand: Abnova
Reference: H00026227-M01
Product name: PHGDH monoclonal antibody (M01), clone 4A3-1D6
Product description: Mouse monoclonal antibody raised against a full length recombinant PHGDH.
Clone: 4A3-1D6
Isotype: IgG1 kappa
Gene id: 26227
Gene name: PHGDH
Gene alias: 3-PGDH|3PGDH|MGC3017|PDG|PGAD|PGD|PGDH|SERA
Gene description: phosphoglycerate dehydrogenase
Genbank accession: BC011262
Immunogen: PHGDH (AAH11262.1, 1 a.a. ~ 533 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
Protein accession: AAH11262.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026227-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (84.37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026227-M01-2-A1-1.jpg
Application image note: PHGDH monoclonal antibody (M01), clone 4A3-1D6. Western Blot analysis of PHGDH expression in human liver.
Applications: WB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice
Publications: Enhanced serine production by bone metastatic breast cancer cells stimulates osteoclastogenesis.Pollari S, Kakonen SM, Edgren H, Wolf M, Kohonen P, Sara H, Guise T, Nees M, Kallioniemi O.
Breast Cancer Res Treat. 2010 Mar 30. [Epub ahead of print]

Reviews

Buy PHGDH monoclonal antibody (M01), clone 4A3-1D6 now

Add to cart