SHFM3P1 monoclonal antibody (M15), clone 2C5 View larger

SHFM3P1 monoclonal antibody (M15), clone 2C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SHFM3P1 monoclonal antibody (M15), clone 2C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about SHFM3P1 monoclonal antibody (M15), clone 2C5

Brand: Abnova
Reference: H00026226-M15
Product name: SHFM3P1 monoclonal antibody (M15), clone 2C5
Product description: Mouse monoclonal antibody raised against a partial recombinant SHFM3P1.
Clone: 2C5
Isotype: IgG2a Kappa
Gene id: 26226
Gene name: FBXW4P1
Gene alias: FBW3|FBXW3|SHFM3P1
Gene description: F-box and WD repeat domain containing 4 pseudogene 1
Genbank accession: AF174606
Immunogen: SHFM3P1 (AAF04527, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EVLLLHMCSYLDMRALGRLAQVYRWLWHFTNCDLLRRQIAWASLNSGFTRLGTNLMTSVPVKVSQNWIVGCCREGILLKWRCSQMPWMQLEDDALYISQA
Protein accession: AAF04527
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026226-M15-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged FBXW4P1 is 3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SHFM3P1 monoclonal antibody (M15), clone 2C5 now

Add to cart