ARL5 monoclonal antibody (M01), clone 1F12-1A6 View larger

ARL5 monoclonal antibody (M01), clone 1F12-1A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARL5 monoclonal antibody (M01), clone 1F12-1A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ARL5 monoclonal antibody (M01), clone 1F12-1A6

Brand: Abnova
Reference: H00026225-M01
Product name: ARL5 monoclonal antibody (M01), clone 1F12-1A6
Product description: Mouse monoclonal antibody raised against a full length recombinant ARL5.
Clone: 1F12-1A6
Isotype: IgG1 kappa
Gene id: 26225
Gene name: ARL5A
Gene alias: ARFLP5|ARL5
Gene description: ADP-ribosylation factor-like 5A
Genbank accession: BC001254
Immunogen: ARL5 (AAH01254, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR
Protein accession: AAH01254
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026225-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged ARL5A is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARL5 monoclonal antibody (M01), clone 1F12-1A6 now

Add to cart