FBXL3 monoclonal antibody (M03), clone 1A3 View larger

FBXL3 monoclonal antibody (M03), clone 1A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXL3 monoclonal antibody (M03), clone 1A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FBXL3 monoclonal antibody (M03), clone 1A3

Brand: Abnova
Reference: H00026224-M03
Product name: FBXL3 monoclonal antibody (M03), clone 1A3
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXL3.
Clone: 1A3
Isotype: IgG2a Kappa
Gene id: 26224
Gene name: FBXL3
Gene alias: FBL3|FBL3A|FBXL3A
Gene description: F-box and leucine-rich repeat protein 3
Genbank accession: NM_012158
Immunogen: FBXL3 (NP_036290, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIK
Protein accession: NP_036290
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026224-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00026224-M03-1-1-1.jpg
Application image note: FBXL3 monoclonal antibody (M03), clone 1A3. Western Blot analysis of FBXL3 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXL3 monoclonal antibody (M03), clone 1A3 now

Add to cart