Brand: | Abnova |
Reference: | H00026224-M03 |
Product name: | FBXL3 monoclonal antibody (M03), clone 1A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FBXL3. |
Clone: | 1A3 |
Isotype: | IgG2a Kappa |
Gene id: | 26224 |
Gene name: | FBXL3 |
Gene alias: | FBL3|FBL3A|FBXL3A |
Gene description: | F-box and leucine-rich repeat protein 3 |
Genbank accession: | NM_012158 |
Immunogen: | FBXL3 (NP_036290, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIK |
Protein accession: | NP_036290 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | FBXL3 monoclonal antibody (M03), clone 1A3. Western Blot analysis of FBXL3 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |