FBXL21 monoclonal antibody (M02), clone 4A1 View larger

FBXL21 monoclonal antibody (M02), clone 4A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXL21 monoclonal antibody (M02), clone 4A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FBXL21 monoclonal antibody (M02), clone 4A1

Brand: Abnova
Reference: H00026223-M02
Product name: FBXL21 monoclonal antibody (M02), clone 4A1
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXL21.
Clone: 4A1
Isotype: IgG2a Kappa
Gene id: 26223
Gene name: FBXL21
Gene alias: FBL3B|FBXL3B|FBXL3P|Fbl21|MGC120237
Gene description: F-box and leucine-rich repeat protein 21
Genbank accession: NM_012159
Immunogen: FBXL21 (NP_036291, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VSKVVLGRVGLNCPRLIELVVCANDLQPLDNELICIAEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSKYLGRVWFPDVMPLW
Protein accession: NP_036291
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026223-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026223-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged FBXL21 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXL21 monoclonal antibody (M02), clone 4A1 now

Add to cart