PTPN22 monoclonal antibody (M02), clone 1A6 View larger

PTPN22 monoclonal antibody (M02), clone 1A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTPN22 monoclonal antibody (M02), clone 1A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about PTPN22 monoclonal antibody (M02), clone 1A6

Brand: Abnova
Reference: H00026191-M02
Product name: PTPN22 monoclonal antibody (M02), clone 1A6
Product description: Mouse monoclonal antibody raised against a partial recombinant PTPN22.
Clone: 1A6
Isotype: IgG2a Kappa
Gene id: 26191
Gene name: PTPN22
Gene alias: LYP|Lyp1|Lyp2|PEP|PTPN8
Gene description: protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Genbank accession: NM_015967
Immunogen: PTPN22 (NP_057051.2, 10 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDF
Protein accession: NP_057051.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026191-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026191-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to PTPN22 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PTPN22 monoclonal antibody (M02), clone 1A6 now

Add to cart