PTPN22 monoclonal antibody (M01), clone 4F6 View larger

PTPN22 monoclonal antibody (M01), clone 4F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTPN22 monoclonal antibody (M01), clone 4F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about PTPN22 monoclonal antibody (M01), clone 4F6

Brand: Abnova
Reference: H00026191-M01
Product name: PTPN22 monoclonal antibody (M01), clone 4F6
Product description: Mouse monoclonal antibody raised against a full length recombinant PTPN22.
Clone: 4F6
Isotype: IgG2a Kappa
Gene id: 26191
Gene name: PTPN22
Gene alias: LYP|Lyp1|Lyp2|PEP|PTPN8
Gene description: protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Genbank accession: BC017785
Immunogen: PTPN22 (AAH17785, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF
Protein accession: AAH17785
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026191-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026191-M01-42-R01V-1.jpg
Application image note: Western blot analysis of PTPN22 over-expressed 293 cell line, cotransfected with PTPN22 Validated Chimera RNAi ( Cat # H00026191-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PTPN22 monoclonal antibody (M01), clone 4F6 (Cat # H00026191-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: Experimental ischemia/reperfusion model impairs endocannabinoid signaling and Na+/K+ ATPase expression and activity in kidney proximal tubule cells.Sampaio LS, Iannotti FA, Veneziani L, Borelli-Torres RT, De Maio F, Piscitelli F, Reis RAM, Di Marzo V, Einicker-Lamas M.
Biochem Pharmacol. 2018 Aug;154:482-491. doi: 10.1016/j.bcp.2018.06.005. Epub 2018 Jun 8.

Reviews

Buy PTPN22 monoclonal antibody (M01), clone 4F6 now

Add to cart