GIMAP2 monoclonal antibody (M01), clone 1E10 View larger

GIMAP2 monoclonal antibody (M01), clone 1E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GIMAP2 monoclonal antibody (M01), clone 1E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GIMAP2 monoclonal antibody (M01), clone 1E10

Brand: Abnova
Reference: H00026157-M01
Product name: GIMAP2 monoclonal antibody (M01), clone 1E10
Product description: Mouse monoclonal antibody raised against a partial recombinant GIMAP2.
Clone: 1E10
Isotype: IgG2a Kappa
Gene id: 26157
Gene name: GIMAP2
Gene alias: DKFZp586D0824|HIMAP2|IMAP2|MGC24275
Gene description: GTPase, IMAP family member 2
Genbank accession: NM_015660
Immunogen: GIMAP2 (NP_056475.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYL
Protein accession: NP_056475.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026157-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026157-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged GIMAP2 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GIMAP2 monoclonal antibody (M01), clone 1E10 now

Add to cart