ZBTB20 monoclonal antibody (M01), clone 1F3 View larger

ZBTB20 monoclonal antibody (M01), clone 1F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZBTB20 monoclonal antibody (M01), clone 1F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about ZBTB20 monoclonal antibody (M01), clone 1F3

Brand: Abnova
Reference: H00026137-M01
Product name: ZBTB20 monoclonal antibody (M01), clone 1F3
Product description: Mouse monoclonal antibody raised against a partial recombinant ZBTB20.
Clone: 1F3
Isotype: IgG2a Kappa
Gene id: 26137
Gene name: ZBTB20
Gene alias: DKFZp566F123|DPZF|HOF|ODA-8S|ZNF288
Gene description: zinc finger and BTB domain containing 20
Genbank accession: NM_015642
Immunogen: ZBTB20 (NP_056457, 451 a.a. ~ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FLFSLPQPLAGQQTQFVTVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRSF
Protein accession: NP_056457
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026137-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026137-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ZBTB20 is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZBTB20 monoclonal antibody (M01), clone 1F3 now

Add to cart