TES monoclonal antibody (M01), clone 1G11-B7 View larger

TES monoclonal antibody (M01), clone 1G11-B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TES monoclonal antibody (M01), clone 1G11-B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr

More info about TES monoclonal antibody (M01), clone 1G11-B7

Brand: Abnova
Reference: H00026136-M01
Product name: TES monoclonal antibody (M01), clone 1G11-B7
Product description: Mouse monoclonal antibody raised against a full length recombinant TES.
Clone: 1G11-B7
Isotype: IgG1 kappa
Gene id: 26136
Gene name: TES
Gene alias: DKFZp586B2022|MGC1146|TESS|TESS-2
Gene description: testis derived transcript (3 LIM domains)
Genbank accession: BC001451
Immunogen: TES (AAH01451, 1 a.a. ~ 421 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS
Protein accession: AAH01451
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026136-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (72.05 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026136-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to TES on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TES monoclonal antibody (M01), clone 1G11-B7 now

Add to cart