Brand: | Abnova |
Reference: | H00026136-M01 |
Product name: | TES monoclonal antibody (M01), clone 1G11-B7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TES. |
Clone: | 1G11-B7 |
Isotype: | IgG1 kappa |
Gene id: | 26136 |
Gene name: | TES |
Gene alias: | DKFZp586B2022|MGC1146|TESS|TESS-2 |
Gene description: | testis derived transcript (3 LIM domains) |
Genbank accession: | BC001451 |
Immunogen: | TES (AAH01451, 1 a.a. ~ 421 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS |
Protein accession: | AAH01451 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (72.05 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to TES on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |