Brand: | Abnova |
Reference: | H00026133-M07 |
Product name: | TRPC4AP monoclonal antibody (M07), clone 3G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRPC4AP. |
Clone: | 3G4 |
Isotype: | IgG2a Kappa |
Gene id: | 26133 |
Gene name: | TRPC4AP |
Gene alias: | C20orf188|TRRP4AP|TRUSS |
Gene description: | transient receptor potential cation channel, subfamily C, member 4 associated protein |
Genbank accession: | NM_015638 |
Immunogen: | TRPC4AP (NP_056453, 341 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPD |
Protein accession: | NP_056453 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TRPC4AP is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |