TRPC4AP monoclonal antibody (M07), clone 3G4 View larger

TRPC4AP monoclonal antibody (M07), clone 3G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRPC4AP monoclonal antibody (M07), clone 3G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about TRPC4AP monoclonal antibody (M07), clone 3G4

Brand: Abnova
Reference: H00026133-M07
Product name: TRPC4AP monoclonal antibody (M07), clone 3G4
Product description: Mouse monoclonal antibody raised against a partial recombinant TRPC4AP.
Clone: 3G4
Isotype: IgG2a Kappa
Gene id: 26133
Gene name: TRPC4AP
Gene alias: C20orf188|TRRP4AP|TRUSS
Gene description: transient receptor potential cation channel, subfamily C, member 4 associated protein
Genbank accession: NM_015638
Immunogen: TRPC4AP (NP_056453, 341 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPD
Protein accession: NP_056453
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026133-M07-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged TRPC4AP is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TRPC4AP monoclonal antibody (M07), clone 3G4 now

Add to cart