FGFR1OP2 monoclonal antibody (M01), clone 2G4 View larger

FGFR1OP2 monoclonal antibody (M01), clone 2G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FGFR1OP2 monoclonal antibody (M01), clone 2G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about FGFR1OP2 monoclonal antibody (M01), clone 2G4

Brand: Abnova
Reference: H00026127-M01
Product name: FGFR1OP2 monoclonal antibody (M01), clone 2G4
Product description: Mouse monoclonal antibody raised against a partial recombinant FGFR1OP2.
Clone: 2G4
Isotype: IgG2a Kappa
Gene id: 26127
Gene name: FGFR1OP2
Gene alias: DKFZp564O1863|HSPC123-like
Gene description: FGFR1 oncogene partner 2
Genbank accession: NM_015633
Immunogen: FGFR1OP2 (NP_056448, 62 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDPGIIMKLKEQHSKIDMVHRNKSEGFFLDASRHILEAPQHGLERRHLEANQ
Protein accession: NP_056448
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026127-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026127-M01-13-15-1.jpg
Application image note: Western Blot analysis of FGFR1OP2 expression in transfected 293T cell line by FGFR1OP2 monoclonal antibody (M01), clone 2G4.

Lane 1: FGFR1OP2 transfected lysate(20.175 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FGFR1OP2 monoclonal antibody (M01), clone 2G4 now

Add to cart