PRPF31 monoclonal antibody (M02), clone 8E1 View larger

PRPF31 monoclonal antibody (M02), clone 8E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRPF31 monoclonal antibody (M02), clone 8E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PRPF31 monoclonal antibody (M02), clone 8E1

Brand: Abnova
Reference: H00026121-M02
Product name: PRPF31 monoclonal antibody (M02), clone 8E1
Product description: Mouse monoclonal antibody raised against a partial recombinant PRPF31.
Clone: 8E1
Isotype: IgG2a Kappa
Gene id: 26121
Gene name: PRPF31
Gene alias: DKFZp566J153|NY-BR-99|PRP31|RP11
Gene description: PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae)
Genbank accession: NM_015629
Immunogen: PRPF31 (NP_056444, 400 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST
Protein accession: NP_056444
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026121-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00026121-M02-2-A1-1.jpg
Application image note: PRPF31 monoclonal antibody (M02), clone 8E1. Western Blot analysis of PRPF31 expression in human liver.
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: An integrative analysis of colon cancer identifies an essential function for PRPF6 in tumor growth.Adler AS, McCleland ML, Yee S, Yaylaoglu M, Hussain S, Cosino E, Quinones G, Modrusan Z, Seshagiri S, Torres E, Chopra VS, Haley B, Zhang Z, Blackwood EM, Singh M, Junttila M, Stephan JP, Liu J, Pau G, Fearon ER, Jiang Z, Firestein R
Genes Dev. 2014 May 15;28(10):1068-84. doi: 10.1101/gad.237206.113. Epub 2014 May 1.

Reviews

Buy PRPF31 monoclonal antibody (M02), clone 8E1 now

Add to cart