Brand: | Abnova |
Reference: | H00026119-M01 |
Product name: | LDLRAP1 monoclonal antibody (M01), clone 4G4-D5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant LDLRAP1. |
Clone: | 4G4-D5 |
Isotype: | IgG1 kappa |
Gene id: | 26119 |
Gene name: | LDLRAP1 |
Gene alias: | ARH|ARH1|ARH2|DKFZp586D0624|FHCB1|FHCB2|MGC34705 |
Gene description: | low density lipoprotein receptor adaptor protein 1 |
Genbank accession: | BC029770 |
Immunogen: | LDLRAP1 (AAH29770, 1 a.a. ~ 263 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGTEQDDLFSF |
Protein accession: | AAH29770 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (54.67 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to LDLRAP1 on formalin-fixed paraffin-embedded human maligant fibrous histiocytoma tissue. [antibody concentration 2 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Autosomal recessive hypercholesterolemia in Spanish kindred due to a large deletion in the ARH gene.Quagliarini F, Vallve JC, Campagna F, Alvaro A, Fuentes-Jimenez FJ, Sirinian MI, Meloni F, Masana L, Arca M. Mol Genet Metab. 2007 Nov;92(3):243-8. Epub 2007 Aug 7. |