LDLRAP1 monoclonal antibody (M01), clone 4G4-D5 View larger

LDLRAP1 monoclonal antibody (M01), clone 4G4-D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LDLRAP1 monoclonal antibody (M01), clone 4G4-D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about LDLRAP1 monoclonal antibody (M01), clone 4G4-D5

Brand: Abnova
Reference: H00026119-M01
Product name: LDLRAP1 monoclonal antibody (M01), clone 4G4-D5
Product description: Mouse monoclonal antibody raised against a full length recombinant LDLRAP1.
Clone: 4G4-D5
Isotype: IgG1 kappa
Gene id: 26119
Gene name: LDLRAP1
Gene alias: ARH|ARH1|ARH2|DKFZp586D0624|FHCB1|FHCB2|MGC34705
Gene description: low density lipoprotein receptor adaptor protein 1
Genbank accession: BC029770
Immunogen: LDLRAP1 (AAH29770, 1 a.a. ~ 263 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGTEQDDLFSF
Protein accession: AAH29770
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026119-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (54.67 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026119-M01-3-17-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to LDLRAP1 on formalin-fixed paraffin-embedded human maligant fibrous histiocytoma tissue. [antibody concentration 2 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Autosomal recessive hypercholesterolemia in Spanish kindred due to a large deletion in the ARH gene.Quagliarini F, Vallve JC, Campagna F, Alvaro A, Fuentes-Jimenez FJ, Sirinian MI, Meloni F, Masana L, Arca M.
Mol Genet Metab. 2007 Nov;92(3):243-8. Epub 2007 Aug 7.

Reviews

Buy LDLRAP1 monoclonal antibody (M01), clone 4G4-D5 now

Add to cart