WSB1 monoclonal antibody (M01), clone 3E10 View larger

WSB1 monoclonal antibody (M01), clone 3E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WSB1 monoclonal antibody (M01), clone 3E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about WSB1 monoclonal antibody (M01), clone 3E10

Brand: Abnova
Reference: H00026118-M01
Product name: WSB1 monoclonal antibody (M01), clone 3E10
Product description: Mouse monoclonal antibody raised against a partial recombinant WSB1.
Clone: 3E10
Isotype: IgG2a Kappa
Gene id: 26118
Gene name: WSB1
Gene alias: SWIP1|WSB-1
Gene description: WD repeat and SOCS box-containing 1
Genbank accession: BC021110
Immunogen: WSB1 (AAH21110.1, 53 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFG
Protein accession: AAH21110.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026118-M01-9-17-1.jpg
Application image note: Detection limit for recombinant GST tagged WSB1 is 10 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy WSB1 monoclonal antibody (M01), clone 3E10 now

Add to cart