PYGO1 monoclonal antibody (M13), clone 3E1 View larger

PYGO1 monoclonal antibody (M13), clone 3E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PYGO1 monoclonal antibody (M13), clone 3E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PYGO1 monoclonal antibody (M13), clone 3E1

Brand: Abnova
Reference: H00026108-M13
Product name: PYGO1 monoclonal antibody (M13), clone 3E1
Product description: Mouse monoclonal antibody raised against a partial recombinant PYGO1.
Clone: 3E1
Isotype: IgG1 Kappa
Gene id: 26108
Gene name: PYGO1
Gene alias: DKFZp547G0910
Gene description: pygopus homolog 1 (Drosophila)
Genbank accession: NM_015617
Immunogen: PYGO1 (NP_056432, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDL
Protein accession: NP_056432
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026108-M13-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026108-M13-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PYGO1 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PYGO1 monoclonal antibody (M13), clone 3E1 now

Add to cart