HERC4 monoclonal antibody (M08), clone 2G7 View larger

HERC4 monoclonal antibody (M08), clone 2G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HERC4 monoclonal antibody (M08), clone 2G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HERC4 monoclonal antibody (M08), clone 2G7

Brand: Abnova
Reference: H00026091-M08
Product name: HERC4 monoclonal antibody (M08), clone 2G7
Product description: Mouse monoclonal antibody raised against a partial recombinant HERC4.
Clone: 2G7
Isotype: IgG2a Kappa
Gene id: 26091
Gene name: HERC4
Gene alias: DKFZp564G092|KIAA1593
Gene description: hect domain and RLD 4
Genbank accession: NM_022079
Immunogen: HERC4 (NP_071362, 341 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VKGNWYPYNGQCLPDIDSEEYFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCPNPTKQIWTVNEALIQKWLSYPSGRFPVEIANEIDGTFSSSGCLNGSF
Protein accession: NP_071362
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026091-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026091-M08-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged HERC4 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HERC4 monoclonal antibody (M08), clone 2G7 now

Add to cart