KLK13 monoclonal antibody (M01), clone 1G9 View larger

KLK13 monoclonal antibody (M01), clone 1G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK13 monoclonal antibody (M01), clone 1G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about KLK13 monoclonal antibody (M01), clone 1G9

Brand: Abnova
Reference: H00026085-M01
Product name: KLK13 monoclonal antibody (M01), clone 1G9
Product description: Mouse monoclonal antibody raised against a partial recombinant KLK13.
Clone: 1G9
Isotype: IgG2b Kappa
Gene id: 26085
Gene name: KLK13
Gene alias: DKFZp586J1923|KLK-L4|KLKL4
Gene description: kallikrein-related peptidase 13
Genbank accession: NM_015596
Immunogen: KLK13 (NP_056411.1, 179 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ANIQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ
Protein accession: NP_056411.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026085-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026085-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged KLK13 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KLK13 monoclonal antibody (M01), clone 1G9 now

Add to cart