DECR2 monoclonal antibody (M03), clone 4A7 View larger

DECR2 monoclonal antibody (M03), clone 4A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DECR2 monoclonal antibody (M03), clone 4A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about DECR2 monoclonal antibody (M03), clone 4A7

Brand: Abnova
Reference: H00026063-M03
Product name: DECR2 monoclonal antibody (M03), clone 4A7
Product description: Mouse monoclonal antibody raised against a partial recombinant DECR2.
Clone: 4A7
Isotype: IgG2a Kappa
Gene id: 26063
Gene name: DECR2
Gene alias: PDCR|SDR17C1
Gene description: 2,4-dienoyl CoA reductase 2, peroxisomal
Genbank accession: BC010740
Immunogen: DECR2 (AAH10740.1, 49 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDI
Protein accession: AAH10740.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026063-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.12 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026063-M03-1-6-1.jpg
Application image note: DECR2 monoclonal antibody (M03), clone 4A7. Western Blot analysis of DECR2 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DECR2 monoclonal antibody (M03), clone 4A7 now

Add to cart