Brand: | Abnova |
Reference: | H00026063-M03 |
Product name: | DECR2 monoclonal antibody (M03), clone 4A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DECR2. |
Clone: | 4A7 |
Isotype: | IgG2a Kappa |
Gene id: | 26063 |
Gene name: | DECR2 |
Gene alias: | PDCR|SDR17C1 |
Gene description: | 2,4-dienoyl CoA reductase 2, peroxisomal |
Genbank accession: | BC010740 |
Immunogen: | DECR2 (AAH10740.1, 49 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDI |
Protein accession: | AAH10740.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | DECR2 monoclonal antibody (M03), clone 4A7. Western Blot analysis of DECR2 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |