Brand: | Abnova |
Reference: | H00026057-M03 |
Product name: | ANKRD17 monoclonal antibody (M03), clone 1D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ANKRD17. |
Clone: | 1D12 |
Isotype: | IgG1 Kappa |
Gene id: | 26057 |
Gene name: | ANKRD17 |
Gene alias: | FLJ22206|GTAR|KIAA0697|NY-BR-16 |
Gene description: | ankyrin repeat domain 17 |
Genbank accession: | NM_032217 |
Immunogen: | ANKRD17 (NP_115593, 2501 a.a. ~ 2603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG |
Protein accession: | NP_115593 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to ANKRD17 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |