ANKRD17 monoclonal antibody (M03), clone 1D12 View larger

ANKRD17 monoclonal antibody (M03), clone 1D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANKRD17 monoclonal antibody (M03), clone 1D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about ANKRD17 monoclonal antibody (M03), clone 1D12

Brand: Abnova
Reference: H00026057-M03
Product name: ANKRD17 monoclonal antibody (M03), clone 1D12
Product description: Mouse monoclonal antibody raised against a partial recombinant ANKRD17.
Clone: 1D12
Isotype: IgG1 Kappa
Gene id: 26057
Gene name: ANKRD17
Gene alias: FLJ22206|GTAR|KIAA0697|NY-BR-16
Gene description: ankyrin repeat domain 17
Genbank accession: NM_032217
Immunogen: ANKRD17 (NP_115593, 2501 a.a. ~ 2603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG
Protein accession: NP_115593
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026057-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.07 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026057-M03-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ANKRD17 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ANKRD17 monoclonal antibody (M03), clone 1D12 now

Add to cart