ANKRD17 monoclonal antibody (M01A), clone 1D8 View larger

ANKRD17 monoclonal antibody (M01A), clone 1D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANKRD17 monoclonal antibody (M01A), clone 1D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ANKRD17 monoclonal antibody (M01A), clone 1D8

Brand: Abnova
Reference: H00026057-M01A
Product name: ANKRD17 monoclonal antibody (M01A), clone 1D8
Product description: Mouse monoclonal antibody raised against a partial recombinant ANKRD17.
Clone: 1D8
Isotype: IgG1 Kappa
Gene id: 26057
Gene name: ANKRD17
Gene alias: FLJ22206|GTAR|KIAA0697|NY-BR-16
Gene description: ankyrin repeat domain 17
Genbank accession: NM_032217
Immunogen: ANKRD17 (NP_115593, 2501 a.a. ~ 2603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG
Protein accession: NP_115593
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy ANKRD17 monoclonal antibody (M01A), clone 1D8 now

Add to cart