Brand: | Abnova |
Reference: | H00026056-M02 |
Product name: | RAB11FIP5 monoclonal antibody (M02), clone 3A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB11FIP5. |
Clone: | 3A8 |
Isotype: | IgG2b Kappa |
Gene id: | 26056 |
Gene name: | RAB11FIP5 |
Gene alias: | DKFZp434H018|GAF1|KIAA0857|RIP11|pp75 |
Gene description: | RAB11 family interacting protein 5 (class I) |
Genbank accession: | NM_015470 |
Immunogen: | RAB11FIP5 (NP_056285.1, 554 a.a. ~ 652 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPP |
Protein accession: | NP_056285.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RAB11FIP5 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |