RAB11FIP5 monoclonal antibody (M02), clone 3A8 View larger

RAB11FIP5 monoclonal antibody (M02), clone 3A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB11FIP5 monoclonal antibody (M02), clone 3A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RAB11FIP5 monoclonal antibody (M02), clone 3A8

Brand: Abnova
Reference: H00026056-M02
Product name: RAB11FIP5 monoclonal antibody (M02), clone 3A8
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB11FIP5.
Clone: 3A8
Isotype: IgG2b Kappa
Gene id: 26056
Gene name: RAB11FIP5
Gene alias: DKFZp434H018|GAF1|KIAA0857|RIP11|pp75
Gene description: RAB11 family interacting protein 5 (class I)
Genbank accession: NM_015470
Immunogen: RAB11FIP5 (NP_056285.1, 554 a.a. ~ 652 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPP
Protein accession: NP_056285.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026056-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026056-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged RAB11FIP5 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAB11FIP5 monoclonal antibody (M02), clone 3A8 now

Add to cart