SENP6 monoclonal antibody (M01), clone 4B7 View larger

SENP6 monoclonal antibody (M01), clone 4B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SENP6 monoclonal antibody (M01), clone 4B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about SENP6 monoclonal antibody (M01), clone 4B7

Brand: Abnova
Reference: H00026054-M01
Product name: SENP6 monoclonal antibody (M01), clone 4B7
Product description: Mouse monoclonal antibody raised against a partial recombinant SENP6.
Clone: 4B7
Isotype: IgG2a Kappa
Gene id: 26054
Gene name: SENP6
Gene alias: FLJ11355|FLJ11887|KIAA0389|KIAA0797|SSP1|SUSP1
Gene description: SUMO1/sentrin specific peptidase 6
Genbank accession: NM_015571
Immunogen: SENP6 (NP_056386, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDGTNLLSVDEDEDSETSKGKKLNRRSEIVANSSGEFILKTYVRRNKSESFKTLKGNPIGLNM
Protein accession: NP_056386
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026054-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026054-M01-3-4-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SENP6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: SENP3-mediated de-conjugation of SUMO2/3 from promyelocytic leukemia is correlated with accelerated cell proliferation under mild oxidative stress.Han Y, Huang C, Sun X, Xiang B, Wang M, Yeh ET, Chen Y, Li H, Shi G, Cang H, Sun Y, Wang J, Wang W, Gao F, Yi J.
J Biol Chem. 2010 Apr 23;285(17):12906-15. Epub 2010 Feb 24.

Reviews

Buy SENP6 monoclonal antibody (M01), clone 4B7 now

Add to cart