ZNF500 monoclonal antibody (M06), clone 2H1 View larger

ZNF500 monoclonal antibody (M06), clone 2H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF500 monoclonal antibody (M06), clone 2H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZNF500 monoclonal antibody (M06), clone 2H1

Brand: Abnova
Reference: H00026048-M06
Product name: ZNF500 monoclonal antibody (M06), clone 2H1
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF500.
Clone: 2H1
Isotype: IgG2a Kappa
Gene id: 26048
Gene name: ZNF500
Gene alias: ZKSCAN18
Gene description: zinc finger protein 500
Genbank accession: NM_021646
Immunogen: ZNF500 (NP_067678, 372 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QRVHTGEKPYPCPECGKRFSQSSSLVIHRRTHSGERPYACTQCGKRFNNSSHFSAHRRTHTGEKPYTCPACGRGFRRGTDLHKHQRTHMGAGSLPTLQPVAPGGPGAKA
Protein accession: NP_067678
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026048-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026048-M06-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF500 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF500 monoclonal antibody (M06), clone 2H1 now

Add to cart