SUSD5 monoclonal antibody (M09), clone 4G3 View larger

SUSD5 monoclonal antibody (M09), clone 4G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUSD5 monoclonal antibody (M09), clone 4G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SUSD5 monoclonal antibody (M09), clone 4G3

Brand: Abnova
Reference: H00026032-M09
Product name: SUSD5 monoclonal antibody (M09), clone 4G3
Product description: Mouse monoclonal antibody raised against a partial recombinant SUSD5.
Clone: 4G3
Isotype: IgG2a Kappa
Gene id: 26032
Gene name: SUSD5
Gene alias: KIAA0527
Gene description: sushi domain containing 5
Genbank accession: XM_171054
Immunogen: SUSD5 (XP_171054, 284 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TTVCSKGSGEQQIMRAVDVRIESNPVPGGTYSALCIKDEEKPCGDPPSFPHTILQGRTGLEMGDELLYVCAPGHIMGHRETAFTLLCNSCGEWYGLVQAC
Protein accession: XP_171054
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026032-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026032-M09-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SUSD5 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SUSD5 monoclonal antibody (M09), clone 4G3 now

Add to cart