THEA monoclonal antibody (M01), clone 4D1 View larger

THEA monoclonal antibody (M01), clone 4D1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of THEA monoclonal antibody (M01), clone 4D1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about THEA monoclonal antibody (M01), clone 4D1

Brand: Abnova
Reference: H00026027-M01
Product name: THEA monoclonal antibody (M01), clone 4D1
Product description: Mouse monoclonal antibody raised against a partial recombinant THEA.
Clone: 4D1
Isotype: IgG1 Kappa
Gene id: 26027
Gene name: ACOT11
Gene alias: BFIT|BFIT1|BFIT2|KIAA0707|STARD14|THEA|THEM1
Gene description: acyl-CoA thioesterase 11
Genbank accession: BC001517
Immunogen: THEA (AAH01517, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADGEGYRNPTEVQMSQLVLPCHTNQRGELSVGQLLKWIDTTACLSAERHAGCPCVTASMDDIYFEHTISVGQVVNIKAKVNRAFNSSMEVGIQVASEDLCSEKQWNVCK
Protein accession: AAH01517
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026027-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00026027-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ACOT11 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy THEA monoclonal antibody (M01), clone 4D1 now

Add to cart