CLIP3 monoclonal antibody (M09), clone 4C11 View larger

CLIP3 monoclonal antibody (M09), clone 4C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLIP3 monoclonal antibody (M09), clone 4C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about CLIP3 monoclonal antibody (M09), clone 4C11

Brand: Abnova
Reference: H00025999-M09
Product name: CLIP3 monoclonal antibody (M09), clone 4C11
Product description: Mouse monoclonal antibody raised against a partial recombinant CLIP3.
Clone: 4C11
Isotype: IgG1 Kappa
Gene id: 25999
Gene name: CLIP3
Gene alias: CLIPR-59|CLIPR59|DKFZp586N1922|FLJ33413|RSNL1
Gene description: CAP-GLY domain containing linker protein 3
Genbank accession: NM_015526
Immunogen: CLIP3 (NP_056341, 447 a.a. ~ 547 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS
Protein accession: NP_056341
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025999-M09-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CLIP3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CLIP3 monoclonal antibody (M09), clone 4C11 now

Add to cart