CHMP2B monoclonal antibody (M02), clone M1 View larger

CHMP2B monoclonal antibody (M02), clone M1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHMP2B monoclonal antibody (M02), clone M1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about CHMP2B monoclonal antibody (M02), clone M1

Brand: Abnova
Reference: H00025978-M02
Product name: CHMP2B monoclonal antibody (M02), clone M1
Product description: Mouse monoclonal antibody raised against a full length recombinant CHMP2B.
Clone: M1
Isotype: IgG1 Kappa
Gene id: 25978
Gene name: CHMP2B
Gene alias: CHMP2.5|DKFZp564O123|DMT1|VPS2-2|VPS2B
Gene description: chromatin modifying protein 2B
Genbank accession: BC001553.1
Immunogen: CHMP2B (AAH01553.1, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
Protein accession: AAH01553.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025978-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged CHMP2B is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CHMP2B monoclonal antibody (M02), clone M1 now

Add to cart