Brand: | Abnova |
Reference: | H00025978-M02 |
Product name: | CHMP2B monoclonal antibody (M02), clone M1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CHMP2B. |
Clone: | M1 |
Isotype: | IgG1 Kappa |
Gene id: | 25978 |
Gene name: | CHMP2B |
Gene alias: | CHMP2.5|DKFZp564O123|DMT1|VPS2-2|VPS2B |
Gene description: | chromatin modifying protein 2B |
Genbank accession: | BC001553.1 |
Immunogen: | CHMP2B (AAH01553.1, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
Protein accession: | AAH01553.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CHMP2B is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |