Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00025970-M01 |
Product name: | SH2B monoclonal antibody (M01), clone 2B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SH2B. |
Clone: | 2B9 |
Isotype: | IgG1 Kappa |
Gene id: | 25970 |
Gene name: | SH2B1 |
Gene alias: | DKFZp547G1110|FLJ30542|KIAA1299|SH2-B|SH2B |
Gene description: | SH2B adaptor protein 1 |
Genbank accession: | BC010704 |
Immunogen: | SH2B (AAH10704, 327 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP |
Protein accession: | AAH10704 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SH2B1 expression in transfected 293T cell line by SH2B1 monoclonal antibody (M01), clone 2B9. Lane 1: SH2B1 transfected lysate(52.917 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |