SH2B monoclonal antibody (M01), clone 2B9 View larger

SH2B monoclonal antibody (M01), clone 2B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH2B monoclonal antibody (M01), clone 2B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SH2B monoclonal antibody (M01), clone 2B9

Brand: Abnova
Reference: H00025970-M01
Product name: SH2B monoclonal antibody (M01), clone 2B9
Product description: Mouse monoclonal antibody raised against a partial recombinant SH2B.
Clone: 2B9
Isotype: IgG1 Kappa
Gene id: 25970
Gene name: SH2B1
Gene alias: DKFZp547G1110|FLJ30542|KIAA1299|SH2-B|SH2B
Gene description: SH2B adaptor protein 1
Genbank accession: BC010704
Immunogen: SH2B (AAH10704, 327 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP
Protein accession: AAH10704
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025970-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025970-M01-13-15-1.jpg
Application image note: Western Blot analysis of SH2B1 expression in transfected 293T cell line by SH2B1 monoclonal antibody (M01), clone 2B9.

Lane 1: SH2B1 transfected lysate(52.917 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SH2B monoclonal antibody (M01), clone 2B9 now

Add to cart