NUDT13 monoclonal antibody (M02), clone 1A9 View larger

NUDT13 monoclonal antibody (M02), clone 1A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUDT13 monoclonal antibody (M02), clone 1A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about NUDT13 monoclonal antibody (M02), clone 1A9

Brand: Abnova
Reference: H00025961-M02
Product name: NUDT13 monoclonal antibody (M02), clone 1A9
Product description: Mouse monoclonal antibody raised against a partial recombinant NUDT13.
Clone: 1A9
Isotype: IgG2b Kappa
Gene id: 25961
Gene name: NUDT13
Gene alias: -
Gene description: nudix (nucleoside diphosphate linked moiety X)-type motif 13
Genbank accession: NM_015901
Immunogen: NUDT13 (NP_056985.3, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFYLFHSLAPLLQTSAHQYLAPRHSLLELERLLGKFGQDAQRIEDSVLIGCSEQQEAWFALDL
Protein accession: NP_056985.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025961-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged NUDT13 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy NUDT13 monoclonal antibody (M02), clone 1A9 now

Add to cart