Brand: | Abnova |
Reference: | H00025945-M01 |
Product name: | PVRL3 monoclonal antibody (M01), clone 1D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PVRL3. |
Clone: | 1D1 |
Isotype: | IgG2a Kappa |
Gene id: | 25945 |
Gene name: | PVRL3 |
Gene alias: | CD113|CDw113|DKFZp566B0846|FLJ90624|PPR3|PRR3|PVRR3|nectin-3 |
Gene description: | poliovirus receptor-related 3 |
Genbank accession: | NM_015480 |
Immunogen: | PVRL3 (NP_056295, 59 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTV |
Protein accession: | NP_056295 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PVRL3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 6 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |