SIN3A monoclonal antibody (M01), clone 1B7 View larger

SIN3A monoclonal antibody (M01), clone 1B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SIN3A monoclonal antibody (M01), clone 1B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SIN3A monoclonal antibody (M01), clone 1B7

Brand: Abnova
Reference: H00025942-M01
Product name: SIN3A monoclonal antibody (M01), clone 1B7
Product description: Mouse monoclonal antibody raised against a partial recombinant SIN3A.
Clone: 1B7
Isotype: IgG1 Kappa
Gene id: 25942
Gene name: SIN3A
Gene alias: DKFZp434K2235|FLJ90319|KIAA0700
Gene description: SIN3 homolog A, transcription regulator (yeast)
Genbank accession: NM_015477
Immunogen: SIN3A (NP_056292.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV
Protein accession: NP_056292.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025942-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025942-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SIN3A is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SIN3A monoclonal antibody (M01), clone 1B7 now

Add to cart