Brand: | Abnova |
Reference: | H00025942-M01 |
Product name: | SIN3A monoclonal antibody (M01), clone 1B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SIN3A. |
Clone: | 1B7 |
Isotype: | IgG1 Kappa |
Gene id: | 25942 |
Gene name: | SIN3A |
Gene alias: | DKFZp434K2235|FLJ90319|KIAA0700 |
Gene description: | SIN3 homolog A, transcription regulator (yeast) |
Genbank accession: | NM_015477 |
Immunogen: | SIN3A (NP_056292.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV |
Protein accession: | NP_056292.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SIN3A is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |