WWTR1 monoclonal antibody (M05), clone 1F1 View larger

WWTR1 monoclonal antibody (M05), clone 1F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WWTR1 monoclonal antibody (M05), clone 1F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about WWTR1 monoclonal antibody (M05), clone 1F1

Brand: Abnova
Reference: H00025937-M05
Product name: WWTR1 monoclonal antibody (M05), clone 1F1
Product description: Mouse monoclonal antibody raised against a partial recombinant WWTR1.
Clone: 1F1
Isotype: IgG2a Kappa
Gene id: 25937
Gene name: WWTR1
Gene alias: DKFZp586I1419|TAZ
Gene description: WW domain containing transcription regulator 1
Genbank accession: NM_015472
Immunogen: WWTR1 (NP_056287.1, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL
Protein accession: NP_056287.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025937-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025937-M05-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to WWTR1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy WWTR1 monoclonal antibody (M05), clone 1F1 now

Add to cart