MTHFD1L monoclonal antibody (M01), clone 1E8 View larger

MTHFD1L monoclonal antibody (M01), clone 1E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTHFD1L monoclonal antibody (M01), clone 1E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about MTHFD1L monoclonal antibody (M01), clone 1E8

Brand: Abnova
Reference: H00025902-M01
Product name: MTHFD1L monoclonal antibody (M01), clone 1E8
Product description: Mouse monoclonal antibody raised against a partial recombinant MTHFD1L.
Clone: 1E8
Isotype: IgG2a Kappa
Gene id: 25902
Gene name: MTHFD1L
Gene alias: DKFZp586G1517|FLJ21145|FTHFSDC1|MTC1THFS|dJ292B18.2
Gene description: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Genbank accession: NM_015440
Immunogen: MTHFD1L (NP_056255, 801 a.a. ~ 899 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG
Protein accession: NP_056255
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025902-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00025902-M01-1-11-1.jpg
Application image note: MTHFD1L monoclonal antibody (M01), clone 1E8 Western Blot analysis of MTHFD1L expression in PC-12 ( Cat # L012V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MTHFD1L monoclonal antibody (M01), clone 1E8 now

Add to cart