Brand: | Abnova |
Reference: | H00025897-M01A |
Product name: | RNF19 monoclonal antibody (M01A), clone 4E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF19. |
Clone: | 4E4 |
Isotype: | IgM Kappa |
Gene id: | 25897 |
Gene name: | RNF19A |
Gene alias: | DKFZp566B1346|DORFIN|RNF19 |
Gene description: | ring finger protein 19A |
Genbank accession: | NM_015435 |
Immunogen: | RNF19 (NP_056250, 739 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKTSCSHGSSDYHTRFATVNILPEVENDRLENSPHQCSISVVTQTASCSEVSQLNHIAEEHGNNGIKPNVDLYFGDALKETNNNHSHQTMELKVAIQTE |
Protein accession: | NP_056250 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |