RNF19 monoclonal antibody (M01A), clone 4E4 View larger

RNF19 monoclonal antibody (M01A), clone 4E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF19 monoclonal antibody (M01A), clone 4E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RNF19 monoclonal antibody (M01A), clone 4E4

Brand: Abnova
Reference: H00025897-M01A
Product name: RNF19 monoclonal antibody (M01A), clone 4E4
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF19.
Clone: 4E4
Isotype: IgM Kappa
Gene id: 25897
Gene name: RNF19A
Gene alias: DKFZp566B1346|DORFIN|RNF19
Gene description: ring finger protein 19A
Genbank accession: NM_015435
Immunogen: RNF19 (NP_056250, 739 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKTSCSHGSSDYHTRFATVNILPEVENDRLENSPHQCSISVVTQTASCSEVSQLNHIAEEHGNNGIKPNVDLYFGDALKETNNNHSHQTMELKVAIQTE
Protein accession: NP_056250
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025897-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RNF19 monoclonal antibody (M01A), clone 4E4 now

Add to cart