TRIM58 monoclonal antibody (M02), clone 2H3 View larger

TRIM58 monoclonal antibody (M02), clone 2H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM58 monoclonal antibody (M02), clone 2H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about TRIM58 monoclonal antibody (M02), clone 2H3

Brand: Abnova
Reference: H00025893-M02
Product name: TRIM58 monoclonal antibody (M02), clone 2H3
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM58.
Clone: 2H3
Isotype: IgG2a Kappa
Gene id: 25893
Gene name: TRIM58
Gene alias: BIA2|DKFZp434C091
Gene description: tripartite motif-containing 58
Genbank accession: NM_015431
Immunogen: TRIM58 (NP_056246, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HYWEVLVGEGAEWGLGVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAGEISFYNVTDGSYIYTFNQLFSGLLR
Protein accession: NP_056246
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy TRIM58 monoclonal antibody (M02), clone 2H3 now

Add to cart