ABI3BP monoclonal antibody (M15), clone 2B8 View larger

ABI3BP monoclonal antibody (M15), clone 2B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABI3BP monoclonal antibody (M15), clone 2B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ABI3BP monoclonal antibody (M15), clone 2B8

Brand: Abnova
Reference: H00025890-M15
Product name: ABI3BP monoclonal antibody (M15), clone 2B8
Product description: Mouse monoclonal antibody raised against a partial recombinant ABI3BP.
Clone: 2B8
Isotype: IgG2b Kappa
Gene id: 25890
Gene name: ABI3BP
Gene alias: FLJ41743|FLJ41754|NESHBP|TARSH
Gene description: ABI family, member 3 (NESH) binding protein
Genbank accession: NM_015429
Immunogen: ABI3BP (NP_056244.2, 511 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KTQFISLKPKIPLSPEVTHTKPAPKQTPRAPPKPKTSPRPRIPQTQPVPKVPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQSEPAPLETRG
Protein accession: NP_056244.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025890-M15-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025890-M15-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ABI3BP is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ABI3BP monoclonal antibody (M15), clone 2B8 now

Add to cart