SUMF2 monoclonal antibody (M02), clone 4B3 View larger

SUMF2 monoclonal antibody (M02), clone 4B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUMF2 monoclonal antibody (M02), clone 4B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SUMF2 monoclonal antibody (M02), clone 4B3

Brand: Abnova
Reference: H00025870-M02
Product name: SUMF2 monoclonal antibody (M02), clone 4B3
Product description: Mouse monoclonal antibody raised against a partial recombinant SUMF2.
Clone: 4B3
Isotype: IgG2a Kappa
Gene id: 25870
Gene name: SUMF2
Gene alias: DKFZp566I1024|DKFZp686I1024|DKFZp686L17160|DKFZp781L1035|MGC99485|pFGE
Gene description: sulfatase modifying factor 2
Genbank accession: NM_015411
Immunogen: SUMF2 (NP_056226, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF
Protein accession: NP_056226
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025870-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025870-M02-1-4-1.jpg
Application image note: SUMF2 monoclonal antibody (M02), clone 4B3 Western Blot analysis of SUMF2 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SUMF2 monoclonal antibody (M02), clone 4B3 now

Add to cart