Brand: | Abnova |
Reference: | H00025870-M02 |
Product name: | SUMF2 monoclonal antibody (M02), clone 4B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SUMF2. |
Clone: | 4B3 |
Isotype: | IgG2a Kappa |
Gene id: | 25870 |
Gene name: | SUMF2 |
Gene alias: | DKFZp566I1024|DKFZp686I1024|DKFZp686L17160|DKFZp781L1035|MGC99485|pFGE |
Gene description: | sulfatase modifying factor 2 |
Genbank accession: | NM_015411 |
Immunogen: | SUMF2 (NP_056226, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF |
Protein accession: | NP_056226 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SUMF2 monoclonal antibody (M02), clone 4B3 Western Blot analysis of SUMF2 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |