PRKD2 monoclonal antibody (M01A), clone 2E4 View larger

PRKD2 monoclonal antibody (M01A), clone 2E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKD2 monoclonal antibody (M01A), clone 2E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PRKD2 monoclonal antibody (M01A), clone 2E4

Brand: Abnova
Reference: H00025865-M01A
Product name: PRKD2 monoclonal antibody (M01A), clone 2E4
Product description: Mouse monoclonal antibody raised against a partial recombinant PRKD2.
Clone: 2E4
Isotype: IgG2b Kappa
Gene id: 25865
Gene name: PRKD2
Gene alias: HSPC187|PKD2
Gene description: protein kinase D2
Genbank accession: BC025307.1
Immunogen: PRKD2 (AAH25307.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDESEDSGVIPGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVE
Protein accession: AAH25307.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025865-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025865-M01A-1-1-1.jpg
Application image note: PRKD2 monoclonal antibody (M01A), clone 2E4 Western Blot analysis of PRKD2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PRKD2 monoclonal antibody (M01A), clone 2E4 now

Add to cart