Brand: | Abnova |
Reference: | H00025865-M01A |
Product name: | PRKD2 monoclonal antibody (M01A), clone 2E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRKD2. |
Clone: | 2E4 |
Isotype: | IgG2b Kappa |
Gene id: | 25865 |
Gene name: | PRKD2 |
Gene alias: | HSPC187|PKD2 |
Gene description: | protein kinase D2 |
Genbank accession: | BC025307.1 |
Immunogen: | PRKD2 (AAH25307.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDESEDSGVIPGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVE |
Protein accession: | AAH25307.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PRKD2 monoclonal antibody (M01A), clone 2E4 Western Blot analysis of PRKD2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |