DFNB31 monoclonal antibody (M02), clone 1D9 View larger

DFNB31 monoclonal antibody (M02), clone 1D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DFNB31 monoclonal antibody (M02), clone 1D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DFNB31 monoclonal antibody (M02), clone 1D9

Brand: Abnova
Reference: H00025861-M02
Product name: DFNB31 monoclonal antibody (M02), clone 1D9
Product description: Mouse monoclonal antibody raised against a partial recombinant DFNB31.
Clone: 1D9
Isotype: IgG2b Kappa
Gene id: 25861
Gene name: DFNB31
Gene alias: CIP98|DKFZp434N014|KIAA1526|RP11-9M16.1|USH2D|WHRN|WI
Gene description: deafness, autosomal recessive 31
Genbank accession: NM_015404
Immunogen: DFNB31 (NP_056219, 808 a.a. ~ 907 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML
Protein accession: NP_056219
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025861-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025861-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged DFNB31 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DFNB31 monoclonal antibody (M02), clone 1D9 now

Add to cart