ARMC8 monoclonal antibody (M01), clone 2D9 View larger

ARMC8 monoclonal antibody (M01), clone 2D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARMC8 monoclonal antibody (M01), clone 2D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about ARMC8 monoclonal antibody (M01), clone 2D9

Brand: Abnova
Reference: H00025852-M01
Product name: ARMC8 monoclonal antibody (M01), clone 2D9
Product description: Mouse monoclonal antibody raised against a partial recombinant ARMC8.
Clone: 2D9
Isotype: IgG1 Kappa
Gene id: 25852
Gene name: ARMC8
Gene alias: HSPC056|MGC10058|MGC4880|S863-2
Gene description: armadillo repeat containing 8
Genbank accession: NM_014154
Immunogen: ARMC8 (NP_054873, 287 a.a. ~ 385 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST
Protein accession: NP_054873
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025852-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025852-M01-13-15-1.jpg
Application image note: Western Blot analysis of ARMC8 expression in transfected 293T cell line by ARMC8 monoclonal antibody (M01), clone 2D9.

Lane 1: ARMC8 transfected lysate(43 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy ARMC8 monoclonal antibody (M01), clone 2D9 now

Add to cart