ZNF345 monoclonal antibody (M01), clone 6G10 View larger

ZNF345 monoclonal antibody (M01), clone 6G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF345 monoclonal antibody (M01), clone 6G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about ZNF345 monoclonal antibody (M01), clone 6G10

Brand: Abnova
Reference: H00025850-M01
Product name: ZNF345 monoclonal antibody (M01), clone 6G10
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF345.
Clone: 6G10
Isotype: IgG2b Kappa
Gene id: 25850
Gene name: ZNF345
Gene alias: HZF10
Gene description: zinc finger protein 345
Genbank accession: NM_003419
Immunogen: ZNF345 (NP_003410, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MENLTKHSIECSSFRGDWECKNQFERKQGSQEGHFSEMIFTPEDMPTFSIQHQRIHTDEKLLECKECGKDFSFVSVLVRHQRIHTGEKPYECKECGKAFGSGANLAYHQRI
Protein accession: NP_003410
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025850-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.95 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025850-M01-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ZNF345 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF345 monoclonal antibody (M01), clone 6G10 now

Add to cart