COG4 monoclonal antibody (M04), clone 3B8 View larger

COG4 monoclonal antibody (M04), clone 3B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COG4 monoclonal antibody (M04), clone 3B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about COG4 monoclonal antibody (M04), clone 3B8

Brand: Abnova
Reference: H00025839-M04
Product name: COG4 monoclonal antibody (M04), clone 3B8
Product description: Mouse monoclonal antibody raised against a partial recombinant COG4.
Clone: 3B8
Isotype: IgG2a Kappa
Gene id: 25839
Gene name: COG4
Gene alias: COD1|DKFZp586E1519
Gene description: component of oligomeric golgi complex 4
Genbank accession: NM_015386
Immunogen: COG4 (NP_056201, 686 a.a. ~ 785 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRLRL
Protein accession: NP_056201
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025839-M04-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged COG4 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy COG4 monoclonal antibody (M04), clone 3B8 now

Add to cart