Brand: | Abnova |
Reference: | H00025839-M04 |
Product name: | COG4 monoclonal antibody (M04), clone 3B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant COG4. |
Clone: | 3B8 |
Isotype: | IgG2a Kappa |
Gene id: | 25839 |
Gene name: | COG4 |
Gene alias: | COD1|DKFZp586E1519 |
Gene description: | component of oligomeric golgi complex 4 |
Genbank accession: | NM_015386 |
Immunogen: | COG4 (NP_056201, 686 a.a. ~ 785 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRLRL |
Protein accession: | NP_056201 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged COG4 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |