RAB26 monoclonal antibody (M01), clone 2H1 View larger

RAB26 monoclonal antibody (M01), clone 2H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB26 monoclonal antibody (M01), clone 2H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RAB26 monoclonal antibody (M01), clone 2H1

Brand: Abnova
Reference: H00025837-M01
Product name: RAB26 monoclonal antibody (M01), clone 2H1
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB26.
Clone: 2H1
Isotype: IgG2a Kappa
Gene id: 25837
Gene name: RAB26
Gene alias: V46133
Gene description: RAB26, member RAS oncogene family
Genbank accession: NM_014353
Immunogen: RAB26 (NP_055168, 157 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKELKRRSMKAPSEPRFRLHDYVKREGRGASCC
Protein accession: NP_055168
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025837-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025837-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged RAB26 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAB26 monoclonal antibody (M01), clone 2H1 now

Add to cart